Package: broom.helpers 1.22.0.9000
broom.helpers: Helpers for Model Coefficients Tibbles
Provides suite of functions to work with regression model 'broom::tidy()' tibbles. The suite includes functions to group regression model terms by variable, insert reference and header rows for categorical variables, add variable labels, and more.
Authors:
broom.helpers_1.22.0.9000.tar.gz
broom.helpers_1.22.0.9000.zip(r-4.7)broom.helpers_1.22.0.9000.zip(r-4.6)broom.helpers_1.22.0.9000.zip(r-4.5)
broom.helpers_1.22.0.9000.tgz(r-4.6-any)broom.helpers_1.22.0.9000.tgz(r-4.5-any)
broom.helpers_1.22.0.9000.tar.gz(r-4.7-any)broom.helpers_1.22.0.9000.tar.gz(r-4.6-any)
broom.helpers_1.22.0.9000.tgz(r-4.6-emscripten)
manual.pdf |manual.html✨
DESCRIPTION |NEWS
card.svg |card.png
broom.helpers/json (API)
| # Install 'broom.helpers' in R: |
| install.packages('broom.helpers', repos = c('https://ddsjoberg.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/larmarange/broom.helpers/issues
Pkgdown/docs site:https://larmarange.github.io
- supported_models - Listing of Supported Models
Last updated from:13fe954e20. Checks:9 OK. Indexed: no.
| Target | Result | Time | Files | Syslog |
|---|---|---|---|---|
| linux-devel-x86_64 | OK | 289 | ||
| source / vignettes | OK | 335 | ||
| linux-release-x86_64 | OK | 238 | ||
| macos-release-arm64 | OK | 168 | ||
| macos-oldrel-arm64 | OK | 245 | ||
| windows-devel | OK | 188 | ||
| windows-release | OK | 204 | ||
| windows-oldrel | OK | 203 | ||
| wasm-release | OK | 219 |
Exports:.assert_package.clean_backticks.escape_regex.get_all_packages_dependencies.get_min_version_required.get_package_dependenciesall_categoricalall_continuousall_contrastsall_dichotomousall_interactionall_interceptsall_ofall_ran_parsall_ran_valsany_ofauto_group_bycontainsends_witheverythinglast_colmatchesmodel_compute_terms_contributionsmodel_get_assignmodel_get_coefficients_typemodel_get_contrastsmodel_get_modelmodel_get_model_framemodel_get_model_matrixmodel_get_nmodel_get_nlevelsmodel_get_offsetmodel_get_pairwise_contrastsmodel_get_responsemodel_get_response_variablemodel_get_termsmodel_get_weightsmodel_get_xlevelsmodel_identify_variablesmodel_list_contrastsmodel_list_higher_order_variablesmodel_list_terms_levelsmodel_list_variablesnum_rangeone_ofplot_marginal_predictionsscope_tidyseq_rangestarts_withtidy_add_coefficients_typetidy_add_contraststidy_add_estimate_to_reference_rowstidy_add_header_rowstidy_add_ntidy_add_pairwise_contraststidy_add_reference_rowstidy_add_term_labelstidy_add_variable_labelstidy_all_effectstidy_and_attachtidy_attach_modeltidy_avg_comparisonstidy_avg_slopestidy_broomtidy_coxphmstidy_detach_modeltidy_disambiguate_termstidy_get_modeltidy_ggpredicttidy_group_bytidy_identify_variablestidy_marginal_contraststidy_marginal_meanstidy_marginal_predictionstidy_marginstidy_multgeetidy_parameterstidy_plus_plustidy_remove_intercepttidy_select_variablestidy_svy_vglmtidy_vgamtidy_with_broom_or_parameterstidy_zeroinflvariables_to_contrastvariables_to_predictvarswhere
Dependencies:backportsbitbit64broomcardsclicliprcpp11crayondplyrforcatsgenericsgluehavenhmslabelledlifecyclemagrittrpillarpkgconfigprettyunitsprogresspurrrR6readrrlangstringistringrtibbletidyrtidyselecttzdbutf8vctrsvroomwithr
Readme and manuals
Help Manual
| Help page | Topics |
|---|---|
| Remove backticks around variable names | .clean_backticks |
| Escapes any characters that would have special meaning in a regular expression | .escape_regex |
| Check a package installation status or minimum required version | .assert_package .get_all_packages_dependencies .get_min_version_required .get_package_dependencies assert_package |
| Compute a matrix of terms contributions | model_compute_terms_contributions model_compute_terms_contributions.default |
| Get the assign attribute of model matrix of a model | model_get_assign model_get_assign.default model_get_assign.fixest model_get_assign.model_fit model_get_assign.svy_vglm model_get_assign.vglm |
| Get coefficient type | model_get_coefficients_type model_get_coefficients_type.biglm model_get_coefficients_type.cch model_get_coefficients_type.clm model_get_coefficients_type.clmm model_get_coefficients_type.clogit model_get_coefficients_type.coxph model_get_coefficients_type.crr model_get_coefficients_type.default model_get_coefficients_type.fixest model_get_coefficients_type.geeglm model_get_coefficients_type.glm model_get_coefficients_type.glmerMod model_get_coefficients_type.LORgee model_get_coefficients_type.model_fit model_get_coefficients_type.multinom model_get_coefficients_type.negbin model_get_coefficients_type.polr model_get_coefficients_type.svyolr model_get_coefficients_type.svy_vglm model_get_coefficients_type.tidycrr model_get_coefficients_type.vgam model_get_coefficients_type.vglm |
| Get contrasts used in the model | model_get_contrasts model_get_contrasts.betareg model_get_contrasts.fixest model_get_contrasts.hurdle model_get_contrasts.model_fit model_get_contrasts.svy_vglm model_get_contrasts.zeroinfl |
| Get the model from model objects | model_get_model model_get_model.default model_get_model.mira |
| Get the model frame of a model | model_get_model_frame model_get_model_frame.biglm model_get_model_frame.coxph model_get_model_frame.default model_get_model_frame.fixest model_get_model_frame.model_fit model_get_model_frame.survreg model_get_model_frame.svycoxph model_get_model_frame.svy_vglm |
| Get the model matrix of a model | model_get_model_matrix model_get_model_matrix.betareg model_get_model_matrix.biglm model_get_model_matrix.brmsfit model_get_model_matrix.cch model_get_model_matrix.clm model_get_model_matrix.default model_get_model_matrix.glmmTMB model_get_model_matrix.LORgee model_get_model_matrix.model_fit model_get_model_matrix.multinom model_get_model_matrix.plm model_get_model_matrix.svy_vglm model_get_model_matrix.vgam model_get_model_matrix.vglm |
| Get the number of observations | model_get_n model_get_n.coxph model_get_n.default model_get_n.glm model_get_n.glmerMod model_get_n.LORgee model_get_n.model_fit model_get_n.multinom model_get_n.survreg model_get_n.tidycrr |
| Get the number of levels for each factor used in 'xlevels' | model_get_nlevels model_get_nlevels.default model_get_nlevels.svy_vglm |
| Get model offset | model_get_offset model_get_offset.default |
| Get pairwise comparison of the levels of a categorical variable | model_get_pairwise_contrasts |
| Get model response | model_get_response model_get_response.default model_get_response.glm model_get_response.glmerMod model_get_response.model_fit |
| Get the name of the response variable | model_get_response_variable model_get_response_variable.default |
| Get the terms of a model | model_get_terms model_get_terms.betareg model_get_terms.brmsfit model_get_terms.cch model_get_terms.default model_get_terms.fixest model_get_terms.glmmTMB model_get_terms.model_fit model_get_terms.svy_vglm |
| Get sampling weights used by a model | model_get_weights model_get_weights.default model_get_weights.fixest model_get_weights.model_fit model_get_weights.svrepglm model_get_weights.svyglm model_get_weights.svy_vglm |
| Get xlevels used in the model | model_get_xlevels model_get_xlevels.brmsfit model_get_xlevels.default model_get_xlevels.felm model_get_xlevels.glmerMod model_get_xlevels.glmmTMB model_get_xlevels.lmerMod model_get_xlevels.model_fit model_get_xlevels.plm model_get_xlevels.svy_vglm |
| Identify for each coefficient of a model the corresponding variable | model_identify_variables model_identify_variables.aov model_identify_variables.clm model_identify_variables.clmm model_identify_variables.default model_identify_variables.gam model_identify_variables.lavaan model_identify_variables.logitr model_identify_variables.model_fit model_identify_variables.svy_vglm |
| List contrasts used by a model | model_list_contrasts model_list_contrasts.default |
| List higher order variables of a model | model_list_higher_order_variables model_list_higher_order_variables.default |
| List levels of categorical terms | model_list_terms_levels model_list_terms_levels.default |
| List all the variables used in a model | model_list_variables model_list_variables.default model_list_variables.lavaan model_list_variables.logitr |
| Scoping a tidy tibble allowing to tidy select | scope_tidy |
| Select helper functions | all_categorical all_continuous all_contrasts all_dichotomous all_interaction all_intercepts all_ran_pars all_ran_vals select_helpers |
| Sequence generation between min and max | seq_range |
| Listing of Supported Models | supported_models |
| Add coefficients type and label as attributes | tidy_add_coefficients_type |
| Add contrasts type for categorical variables | tidy_add_contrasts |
| Add an estimate value to references rows for categorical variables | tidy_add_estimate_to_reference_rows |
| Add header rows variables with several terms | tidy_add_header_rows |
| Add the (weighted) number of observations | tidy_add_n |
| Add pairwise contrasts for categorical variables | tidy_add_pairwise_contrasts |
| Add references rows for categorical variables | tidy_add_reference_rows |
| Add term labels | tidy_add_term_labels |
| Add variable labels | tidy_add_variable_labels |
| Marginal Predictions at the mean with 'effects::allEffects()' | tidy_all_effects |
| Attach a full model to the tibble of model terms | tidy_and_attach tidy_attach_model tidy_detach_model tidy_get_model |
| Marginal Contrasts with 'marginaleffects::avg_comparisons()' | tidy_avg_comparisons |
| Marginal Slopes / Effects with 'marginaleffects::avg_slopes()' | tidy_avg_slopes |
| Tidy with 'broom::tidy()' and checks that all arguments are used | tidy_broom |
| Tidy a multi-state survival model | tidy_coxphms |
| Disambiguate terms | tidy_disambiguate_terms |
| Marginal Predictions with 'ggeffects::ggpredict()' | tidy_ggpredict |
| Group results by selected columns | auto_group_by tidy_group_by |
| Identify the variable corresponding to each model coefficient | tidy_identify_variables |
| Marginal Contrasts with 'marginaleffects::avg_comparisons()' | tidy_marginal_contrasts variables_to_contrast |
| Marginal Means with deprecated 'marginaleffects::marginal_means()' | tidy_marginal_means |
| Marginal Predictions with 'marginaleffects::avg_predictions()' | plot_marginal_predictions tidy_marginal_predictions variables_to_predict |
| Average Marginal Effects with 'margins::margins()' | tidy_margins |
| Tidy a 'multgee' model | tidy_multgee |
| Tidy a model with parameters package | tidy_parameters |
| Tidy a model and compute additional informations | tidy_plus_plus |
| Remove intercept(s) | tidy_remove_intercept |
| Select variables to keep/drop | tidy_select_variables |
| Tidy a 'svy_vglm' model | tidy_svy_vglm |
| Tidy a 'vglm' or a 'vgam' model | tidy_vgam |
| Tidy a model with broom or parameters | tidy_with_broom_or_parameters |
| Tidy a 'zeroinfl' or a 'hurdle' model | tidy_zeroinfl |
